Skip to product information
TB-500 (Thymosin Beta-4)

TB-500 (Thymosin Beta-4)

£15.00
TB500 (Thymosin Beta-4)

 

TB-500 (Thymosin Beta-4) – Advanced Research Peptide

 

Description:

TB-500, also known as Thymosin Beta-4, is a synthetic research peptide developed for advanced scientific exploration into cellular function, actin regulation, and tissue response mechanisms. It is produced under controlled laboratory conditions to ensure consistency, purity, and reliability in experimental research environments.

 

Product Information:

 

  • Product Name: TB-500 (Thymosin Beta-4)
  • Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S
  • Molecular Weight: 4963.4 g/mol
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Powder
  • Purity: ≥98%

 

 

Usage and Storage:

Supplied as a lyophilised powder for maximum stability and ease of handling in laboratory applications. Store in a cool, dry environment away from direct light. Once reconstituted, refrigerate and use within the recommended laboratory timeframe. Follow UK Chems’ best-practice guidelines for handling and storage.

 

Synthesis and Quality Assurance:

Each batch of TB-500 (Thymosin Beta-4) is synthesised using advanced peptide production techniques and undergoes extensive analytical testing to verify identity, purity, and structural integrity. This ensures dependable results and reproducibility in research applications.

 

Legal and Safety Information:

This compound is intended strictly for laboratory research use only. TB-500 (Thymosin Beta-4) is not for human consumption or clinical use. UK Chems upholds high standards of quality, compliance, and ethical responsibility in the supply of all research-grade peptides.

You may also like